PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00109227001
Common NameGSBRNA2T00109227001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 1623aa    MW: 178470 Da    PI: 7.307
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00109227001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.73.6e-10854895346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +WT eE e ++   +++G++ +k+Ia+ +   +t  +c+++++k
  GSBRNA2T00109227001 854 PWTSEEKETFLSMLAMHGKD-FKKIASFLT-QKTTADCIDYYYK 895
                          8*****************99.********9.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-14837898IPR009057Homeodomain-like
PROSITE profilePS5129315.171850901IPR017884SANT domain
SMARTSM007171.0E-8851899IPR001005SANT/Myb domain
PfamPF002492.1E-8853895IPR001005SANT/Myb domain
CDDcd001672.53E-7854896No hitNo description
Gene3DG3DSA:1.10.10.605.3E-7854900IPR009057Homeodomain-like
PROSITE profilePS5129310.83210641115IPR017884SANT domain
SMARTSM007172.0E-510651113IPR001005SANT/Myb domain
SuperFamilySSF466896.01E-810681115IPR009057Homeodomain-like
CDDcd001675.53E-510691110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1623 aa     Download sequence    Send to blast
MPPQDHSSWD RKDLLRQRKH ERPSEPPFDP PPFRWRDSPS SSSSHREFSR WGGSADFRRP  60
SSHGKQGGRY QFVEESSHGY TSSRSSARMF ENDYYRPSAP RGDWRYTRNC RDDRVPLSQK  120
DWRSNTWEMN NGSYRAFDRP CGVRNGRRSV EERPPPASDT HTTVVNSWEQ PNSAQQMDIE  180
LCTPVRTVRS KNEQKFLDQR QSLPSDPHSD GLGLFDRPSS VNSYENKECS PAKQSNGLMR  240
GRRLADDNSL DPPILNAEIE GTRNQILLKD MHDNKLHGVS DLDGVRENGK ENSLGATGKL  300
PMWTRSGSFA SQSSGFSHSS SLKSLGAVDS SDGKHKILPK TVAVTQTSSG DATACAKTTV  360
SEEMSSRKKQ RLGWGEGLAK YENKKVDVNT TEDGTDLLEN SAEEMHSLNK NIADKSPTAT  420
NAPDYGSPTT PSSVACNSSP DKSSAKAAIG ASDVSNMCRS PSPVSSIHLE RLPINIEELD  480
NISMERVGCL LNELLGTDDP GTGDSSSVQL TSMKKLLAWK GDILKAVEMA ESEIDLLESK  540
QRALKLECGR QCRVVGPSSD LPEGDENVQQ EASCVLGLKA VAFSVAQTLV RDTVHQAVSA  600
KVPVRIIEDS CREVNALPQF LATVGSNEDI LPIPSTKADS NQETVDLSSA DDSMVSDEDL  660
LCAKLLSTNK IYASESSQVF NKLLPRDFSS FDESRLPGRC QRQFDSHVKE KIAERIEVLR  720
AREKILLLQF KAFQLAWKKD VRQLASAKYQ PKGNKKTEVF PYAKNGGHLK LSQPVRLRLY  780
SSAQRRDSVA STTELVSYMK KLLKNTRLKP FRDILRMPAM ILDEKERVRS RFISSNGLIE  840
DPCDVEKERT MINPWTSEEK ETFLSMLAMH GKDFKKIASF LTQKTTADCI DYYYKNHKSD  900
CFAKIKKQRS FGKEGKHTYM LAPTKKWKRE MGAASLDILG AVSIIAANAG KVASTRQTSS  960
KRITLRGCSS SSSLQRDGNY SEGYSHSFDF PRKRTLGADV VAVGPLSSEQ INSCLRTSVN  1020
SREGCMDHLK FAPAAKKPRI SHTTHNENSN EDDDSCSEES CGETGPIHWT DAERSAFIQG  1080
FSLFGKNFAS LSRFVRTRSP DQCRVFFSKV RKCLGLECIQ SGSRNVSASA SVDNANEGGG  1140
SDLDGPCATE SNSGICNNGV SSKIGLNTLT SPLNMNQEGA NHSGFENVEA GLSRSEQENG  1200
LALLRLKDGT NLVSTANING DSEPCRDLVD INTVESHCQA ADQMNSNDSS DQLSMEIDEG  1260
NLTPIAVSSD PLYCGSIVLS NNIVEKGSGC EGAVVPKQSS KMQDGVMQAV NRTRNSGLEA  1320
EAASSSFRYP ECLHHVPIEE DLVGVSVPQG DSNCHIESEL PNPLVVQTNN MGWQFSEVNL  1380
DFDRRSQVLG HVKPEQNGQL HATSTESCQI PWISFTQDPS RIIRSKSDLI VKAQRTGEAF  1440
SLKKCTSSAT KPLTVFQKDG RSGHSRSHSF SLSDTKRLDK NGDVKLFGTV LTADENGSKQ  1500
KHNPGGSIRP SSTLSRDHET GHQYINQQHL QNVPITSYGF WDGNRIQTGL TSLPESAKLV  1560
ASYPEALTTH QKQQVVSTKE IQLDVSGILS FGKQIEDRSE VSSGKDKGKI GGEVNGVAEA  1620
AT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C8e-18812902493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D8e-18812902493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.165320.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00109227001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013663146.10.0PREDICTED: uncharacterized protein LOC106367835
TrEMBLA0A078C9W50.0A0A078C9W5_BRANA; BnaC08g23560D protein
STRINGBra006915.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]